Ji-Hong Shen, Shu-Bai Liu, Ying-Xia Zhang, Yang Jin, Wen-Hui Lee, Yun Zhang
Department of Animal Toxinology, Kunming Institute of Zoology, The Chinese Academy of Sciences, 32 East Jiao Chang Road, Kunming, Yunnan 650223, China.
Regulatory peptides 2005 Dec 15Amphibian skin is a rich resource of bioactive peptides like proline-rich bombesin from frog Bombina maxima. A novel cDNA clone encoding a precursor protein that comprises proline-rich bombesin and a novel peptide, designated as bombestatin, was isolated from a skin cDNA library of B. maxima. The predicted primary structure of the novel peptide is WEVLLNVALIRLELLSCRSSKDQDQKESCGMHSW, in which two cysteines form a disulfide bond. A BLAST search of databases did not detect sequences with significant similarity. Bombestatin possesses dose-dependent contractile activity on rat stomach strips. The differences between cDNAs encoding PR-bombesin plus bombestatin and PR-bombesin alone are due to fragment insertions located in 3'-coding region and 3'-untranslational region, respectively.
Ji-Hong Shen, Shu-Bai Liu, Ying-Xia Zhang, Yang Jin, Wen-Hui Lee, Yun Zhang. Cloning of novel bombesin precursor cDNAs from skin of Bombina maxima. Regulatory peptides. 2005 Dec 15;132(1-3):102-6
Mesh Tags
Substances
PMID: 16203047
View Full Text