Clear Search sequence regions


Sizes of these terms reflect their relevance to your search.

Amphibian skin is a rich resource of bioactive peptides like proline-rich bombesin from frog Bombina maxima. A novel cDNA clone encoding a precursor protein that comprises proline-rich bombesin and a novel peptide, designated as bombestatin, was isolated from a skin cDNA library of B. maxima. The predicted primary structure of the novel peptide is WEVLLNVALIRLELLSCRSSKDQDQKESCGMHSW, in which two cysteines form a disulfide bond. A BLAST search of databases did not detect sequences with significant similarity. Bombestatin possesses dose-dependent contractile activity on rat stomach strips. The differences between cDNAs encoding PR-bombesin plus bombestatin and PR-bombesin alone are due to fragment insertions located in 3'-coding region and 3'-untranslational region, respectively.

Citation

Ji-Hong Shen, Shu-Bai Liu, Ying-Xia Zhang, Yang Jin, Wen-Hui Lee, Yun Zhang. Cloning of novel bombesin precursor cDNAs from skin of Bombina maxima. Regulatory peptides. 2005 Dec 15;132(1-3):102-6

Expand section icon Mesh Tags

Expand section icon Substances


PMID: 16203047

View Full Text